★★★★★
★★★★★
Verified Buyer
It was my first time ordering from this company and the process was quick and easy.
Verwendung: Dieses Produkt ist ausschließlich für Forschungszwecke bestimmt.
Alle Produktinformationen auf dieser Website dienen ausschließlich Bildungszwecken. Jede Form der Einbringung in den Körper von Menschen oder Tieren ist gesetzlich streng verboten. Dieses Produkt darf nur von zugelassenen und qualifizierten Fachleuten gehandhabt werden. Es ist kein Arzneimittel, Lebensmittel oder Kosmetikum und darf nicht als solches gekennzeichnet, verwendet oder falsch etikettiert werden.
99 % Reinheit garantiert
Nur für Forschungszwecke
Sichere Kasse
GLP-2 (Teduglutide / GLP-2 Analogue 5mg Lyophilized Vial)
GLP-2 (Glucagon-Like Peptide-2) 5mg lyophilized peptide standard for intestinal mucosal, crypt cell, and gastrointestinal barrier research.
Bewährte Formel. Neues Design.
Während der Umstellung unserer Verpackung erhalten Sie möglicherweise Produkte mit dem bisherigen oder dem neuen Etikett. Formulierung, Reinheit und Qualität bleiben nach unseren Standards genau gleich.
Akzeptierte Zahlungsmethoden
- Kreditkarte
- Banküberweisung (SEPA Echtzeit)
- Banküberweisung (ACH)
- Wise
- Revolut
- Zelle
- Remitly
- Western Union
- Chime
- Andere
-25% auf alles – bis 31. Oktober
25% auf reguläre Preise statt anderer Angebote. Nur mit dem Krypto-Zahlungsrabatt kombinierbar.
Laborgeprüft
Jede Charge wird auf Reinheit, Wirksamkeit und Qualität geprüft.
Laborergebnisse ansehen →Übersicht
Peptide Monograph: GLP-2 (33 Amino Acids)
Glucagon-Like Peptide-2 (GLP-2) is a 33-amino-acid peptide co-secreted with GLP-1 from intestinal L-cells. It selectively activates the GLP-2 receptor in enteric neurons and subepithelial myofibroblasts, promoting mucosal growth, crypt cell proliferation, and mesenteric blood flow.
Eigenschaften
- Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITD
- Molecular Weight: 3752.1 g/mol
- Purity: ≥98.0% HPLC
- Format: 5mg Lyophilized Cake in 3ml sterile vial
- Reconstitution: Reconstitute with 1.0ml sterile bacteriostatic water.
- Storage: Store at -20°C. Protect from moisture and light.
Customer Reviews (8)
★★★★★
★★★★★
5 / 5
★★★★★
★★★★★
Verified Buyer
The quality is excellent, and the delivery was prompt.
★★★★★
★★★★★
Verified Buyer
Surpasses all competitors—best product ever.
★★★★★
★★★★★
Verified Buyer
Finally a place to trust. Definitely a bi-weekly customer here.
★★★★★
★★★★★
Verified Buyer
Fast shipping , great value. My current source and a good one. Reliable shipping, I never have to track rest assured it will show up in my mailbox in 2 to 3 days.
★★★★★
★★★★★
Verified Buyer
Exceptional service on the super fast shipping, quality is stellar. I will definitely be back. Results from my tests exceeded all expectations.
★★★★★
★★★★★
Verified Buyer
Highly satisfied with the fast turnaround times, it's an exceptionally pure batch. My laboratory research results exceeded expectations. Excellent all-round service.
★★★★★
★★★★★
Verified Buyer
Top-notch quality from the support team and the quality is absolutely top-tier. Our research results are completely exceeding expectations. Thanks for the outstanding support!
